PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG006304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YA
Protein Properties Length: 233aa    MW: 25452.6 Da    PI: 10.3626
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG006304.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.81.6e-3275131158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  d p+YVNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh hAl+R RgsgGrF
  CCG006304.1  75 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-VKNRKPYLHESRHIHALNRVRGSGGRF 131
                  57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-3673134IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.8974134IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-247799IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.0E-2877131IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068607999IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.4E-24108131IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MRPVLLLSTP DGVSNHSQAD CSYSVVRTPY PCADPYFGGL FNPYGPHAFI QPQMGSHVVG  60
MTAGRVPLPL DLADDGPIYV NAKQYHGILR RRQSRAKLEA QNKLVKNRKP YLHESRHIHA  120
LNRVRGSGGR FLSTKKLQRS DPMSSNGQCN VLDTIHLHPK NDASELESCQ SRTGQSSASK  180
TTRSDTTSVS NSDVNFRQPD RRFSGIAAHL GGGVQINGGL MSSGTQHHAS VVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-2275136263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045960.11e-173PREDICTED: nuclear transcription factor Y subunit A-3-like
TrEMBLB9HDV61e-162B9HDV6_POPTR; CCAAT-binding transcription factor family protein
STRINGPOPTR_0006s14740.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69493149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.16e-48nuclear factor Y, subunit A3